SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62988340|ref|NP_001017924.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62988340|ref|NP_001017924.1|
Domain Number 1 Region: 37-253
Classification Level Classification E-value
Superfamily L domain-like 8.69e-32
Family Ngr ectodomain-like 0.0059
Further Details:      
 
Domain Number 2 Region: 251-345
Classification Level Classification E-value
Superfamily Immunoglobulin 6.11e-17
Family I set domains 0.031
Further Details:      
 
Weak hits

Sequence:  gi|62988340|ref|NP_001017924.1|
Domain Number - Region: 367-433
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00016
Family Fibronectin type III 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|62988340|ref|NP_001017924.1|
Sequence length 550
Comment leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 precursor [Homo sapiens]
Sequence
MASVFHYFLLVLVFLDTHAAQPFCLPGCTCSEESFGRTLQCTSVSLGKIPGNLSEEFKQV
RIENSPLFEMPQGSFINMSTLEYLWLNFNNISVIHLGALEHLPELRELRLEGNKLCSVPW
TAFRATPLLRVLDLKRNKIDALPELALQFLVSLTYLDLSSNRLTVVSKSVFLNWPAYQKC
RQPDCGAEILSSLVVALHDNPWVCDCRLRGLVQFVKSITLPVILVNSYLICQGPLSKAGQ
LFHETELSACMKPQISTPSANITIRAGQNVTLRCLAQASPSPSIAWTYPLSMWREFDVLT
SSTGEDTALSELAIPAAHLVDSGNYTCMASNSIGKSNLVISLHVQPAQALHAPDSLSIPS
EGNAYIDLRVVKQTVHGILLEWLAVADTSKEEWFTLYIASDEAFRKEVVHIGPGINTYAV
DDLLPGTKYEACLSLEGQPPHQGQCVAFVTGRDAGGLEAREHLLHVTVVLCVVLLAVPVG
AYAWAAQGPCSCSKWVLRGCLHRRKAPSCTPAAPQSKDGSFREHPAVCDDGEGHIDTEGD
KEKGGTEDNS
Download sequence
Identical sequences A6NDA9
ENSP00000361185 ENSP00000361185 NP_001017924.1.87134 NP_001017924.1.92137 NYSGRC-IgSF-LRIT2_HUMAN gi|62988340|ref|NP_001017924.1| 9606.ENSP00000361185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]