SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|63054819|ref|NP_714542.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|63054819|ref|NP_714542.1|
Domain Number 1 Region: 35-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000191
Family Glutathione peroxidase-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|63054819|ref|NP_714542.1|
Sequence length 226
Comment hypothetical protein LOC195827 [Homo sapiens]
Sequence
MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVV
VFVRHFLCYICKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVD
PEREIYKRLGMKRGEEIASSGQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTL
ILGPGNNIHFIHRDRNRLDHKPINSVLQLVGVQHVNFTNRPSVIHV
Download sequence
Identical sequences Q7RTV5
ENSP00000398933 9606.ENSP00000364382 ENSP00000364382 ENSP00000364382 gi|63054819|ref|NP_714542.1| NP_714542.1.87134 NP_714542.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]