SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|63054822|ref|NP_001017440.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|63054822|ref|NP_001017440.1|
Domain Number 1 Region: 30-157
Classification Level Classification E-value
Superfamily EF-hand 8.06e-26
Family Calmodulin-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|63054822|ref|NP_001017440.1|
Sequence length 219
Comment calcium-binding protein 8 isoform 2 [Homo sapiens]
Sequence
MPFHHVTAGLLYKGNYLNRSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQE
LGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTID
SIFWQFDMQRITLEELKHILYHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHS
QKQNRQTCVRKSLICAFAMAFIISVMLIAANQILRSGME
Download sequence
Identical sequences A0A1S2ZS61 A0A286XWF1 A0A2J8IXX9 A4D1Z1 F1RJJ5 H2PLZ7 H9ENI0 Q9BXU9
9600.ENSPPYP00000019633 ENSMICP00000001322 gi|63054822|ref|NP_001017440.1| ENSEEUP00000005808 ENSOPRP00000002931 ENSOPRP00000002931 ENSP00000332498 ENSP00000378691 ENSP00000410704 ENSP00000332498 ENSP00000378691 ENSP00000384354 ENSP00000410704 NP_001017440.1.87134 NP_001017440.1.92137 XP_002817926.2.23681 XP_003794259.1.62490 XP_003811066.1.60992 XP_004021000.1.66739 XP_004268810.1.21590 XP_004268811.1.21590 XP_004268812.1.21590 XP_004380833.1.4749 XP_004587078.1.84141 XP_004587079.1.84141 XP_004615979.1.94378 XP_004630463.1.9945 XP_004688373.1.23501 XP_004688374.1.23501 XP_005224991.1.76553 XP_005224992.1.76553 XP_005224994.1.76553 XP_005396784.1.28644 XP_005396785.1.28644 XP_005396786.1.28644 XP_005396787.1.28644 XP_005889937.1.15283 XP_006859780.1.41390 XP_006889723.1.29581 XP_007186578.1.59432 XP_007186579.1.59432 XP_007186580.1.59432 XP_007186581.1.59432 XP_007186582.1.59432 XP_007469973.1.90284 XP_007523717.1.11023 XP_007523718.1.11023 XP_008016483.1.81039 XP_008016485.1.81039 XP_008016486.1.81039 XP_008523971.1.77740 XP_008523972.1.77740 XP_008523973.1.77740 XP_008523974.1.77740 XP_008961616.1.60992 XP_008961617.1.60992 XP_008961618.1.60992 XP_009451614.1.37143 XP_009451615.1.37143 XP_010623323.1.5607 XP_010623325.1.5607 XP_010623326.1.5607 XP_010623327.1.5607 XP_011514897.1.92137 XP_011514898.1.92137 XP_011514899.1.92137 XP_011514901.1.92137 XP_011713619.1.29376 XP_011713622.1.29376 XP_011713623.1.29376 XP_011713624.1.29376 XP_011713625.1.29376 XP_011713626.1.29376 XP_011713627.1.29376 XP_011713629.1.29376 XP_011713630.1.29376 XP_011787536.1.43180 XP_011787542.1.43180 XP_011848263.1.47321 XP_011848264.1.47321 XP_011959832.1.66739 XP_011959834.1.66739 XP_011959838.1.66739 XP_011999163.1.54773 XP_011999164.1.54773 XP_011999166.1.54773 XP_011999167.1.54773 XP_011999168.1.54773 XP_012304510.1.9421 XP_012304511.1.9421 XP_012304512.1.9421 XP_012388127.1.21590 XP_012495724.1.63892 XP_012495725.1.63892 XP_012584545.1.23501 XP_012584546.1.23501 XP_012619524.1.48125 XP_012619525.1.48125 XP_012663313.1.62490 XP_013003722.1.53824 XP_013003723.1.53824 XP_013003724.1.53824 XP_013003725.1.53824 XP_013376101.1.28644 XP_013376102.1.28644 XP_014201172.1.60992 XP_014650121.1.5094 XP_014697754.1.49734 XP_015315863.1.76553 XP_015315864.1.76553 XP_016813123.1.37143 XP_016813124.1.37143 XP_016868167.1.92137 XP_016868168.1.92137 XP_016868169.1.92137 XP_016868170.1.92137 XP_016868171.1.92137 XP_016868172.1.92137 XP_017198064.1.1745 XP_017365209.1.71028 XP_017365210.1.71028 XP_017750689.1.44346 XP_017750690.1.44346 XP_017896505.1.57651 XP_018887249.1.27298 XP_020942009.1.46622 XP_020942010.1.46622 XP_020942011.1.46622 XP_020942012.1.46622 XP_020942013.1.46622 XP_020942014.1.46622 ENSEEUP00000005808 ENSPPYP00000019633 ENSMICP00000001322 ENSPPYP00000019633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]