SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|63999048|ref|NP_848604.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|63999048|ref|NP_848604.3|
Domain Number 1 Region: 22-94
Classification Level Classification E-value
Superfamily PDZ domain-like 7.32e-18
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 2 Region: 495-530
Classification Level Classification E-value
Superfamily WW domain 0.00000000000208
Family WW domain 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|63999048|ref|NP_848604.3|
Domain Number - Region: 217-264
Classification Level Classification E-value
Superfamily EF-hand 0.000116
Family Calmodulin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|63999048|ref|NP_848604.3|
Sequence length 553
Comment syntaxin-binding protein 4 [Homo sapiens]
Sequence
MNKNTSTVVSPSLLEKDPAFQMITIAKETGLGLKVLGGINRNEGPLVYIQEIIPGGDCYK
DGRLKPGDQLVSVNKESMIGVSFEEAKSIITGAKLRLESAWEIAFIRQKSDNIQPENLSC
TSLIEASGEYGPQASTLSLFSSPPEILIPKTSSTPKTNNDILSSCEIKTGYNKTVQIPIT
SENSTVGLSNTDVASAWTENYGLQEKISLNPSVRFKAEKLEMALNYLGIQPTKEQHQALR
QQVQADSKGTVSFGDFVQVARNLFCLQLDEVNVGAHEISNILDSQLLPCDSSEADEMERL
KCERDDALKEVNTLKEKLLESDKQRKQLTEELQNVKQEAKAVVEETRALRSRIHLAEAAQ
RQAHGMEMDYEEVIRLLEAKITELKAQLADYSDQNKESVQDLKKRIMVLDCQLRKSEMAR
KTFEASTEKLLHFVEAIQEVFSDNSTPLSNLSERRAVLASQTSLTPLGRNGRSIPATLAL
ESKELVKSVRALLDMDCLPYGWEEAYTADGIKYFINHVTQTTSWIHPVMSVLNLSRSEEN
EEDCSRELPNQKS
Download sequence
Identical sequences Q6ZWJ1
9606.ENSP00000365530 ENSP00000365530 ENSP00000365530 ENSP00000299341 NP_848604.3.87134 NP_848604.3.92137 gi|63999048|ref|NP_848604.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]