SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|65506745|ref|NP_001018074.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|65506745|ref|NP_001018074.1|
Domain Number 1 Region: 517-805
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.56e-85
Family Protein kinases, catalytic subunit 0.000000137
Further Details:      
 
Domain Number 2 Region: 66-166
Classification Level Classification E-value
Superfamily L domain-like 6.05e-16
Family Ngr ectodomain-like 0.00042
Further Details:      
 
Domain Number 3 Region: 203-290
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000185
Family I set domains 0.039
Further Details:      
 
Domain Number 4 Region: 283-383
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000278
Family I set domains 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|65506745|ref|NP_001018074.1|
Sequence length 822
Comment BDNF/NT-3 growth factors receptor isoform c precursor [Homo sapiens]
Sequence
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASP
LHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVL
KRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHI
VKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQI
AAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWM
PPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQ
EVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Download sequence
Identical sequences H2QXE4 Q16620 Q548C2
gi|65506745|ref|NP_001018074.1| NYSGRC-IgSF-NTRK2_HUMAN NP_001018074.1.87134 NP_001018074.1.92137 XP_001135401.1.37143 XP_002819955.1.23681 XP_003809233.1.60992 XP_011517020.1.92137 XP_016816538.1.37143 XP_016870241.1.92137 XP_016870242.1.92137 XP_016870243.1.92137 ENSP00000314586 ENSP00000365386 ENSP00000314586 ENSP00000365386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]