SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|65506779|ref|NP_001018076.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|65506779|ref|NP_001018076.1|
Domain Number 1 Region: 66-166
Classification Level Classification E-value
Superfamily L domain-like 3.06e-16
Family Ngr ectodomain-like 0.00042
Further Details:      
 
Domain Number 2 Region: 203-290
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000101
Family I set domains 0.039
Further Details:      
 
Domain Number 3 Region: 283-383
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000151
Family I set domains 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|65506779|ref|NP_001018076.1|
Sequence length 537
Comment BDNF/NT-3 growth factors receptor isoform e precursor [Homo sapiens]
Sequence
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASP
LHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTWPRGSPKTA
Download sequence
Identical sequences A0A2J8MRP8
ENSP00000365381 ENSP00000365381 gi|65506779|ref|NP_001018076.1| NP_001018076.1.87134 NP_001018076.1.92137 XP_008959620.1.60992 XP_009455073.1.37143 XP_011517022.1.92137 XP_016816540.1.37143 XP_016870246.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]