SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|66346695|ref|NP_001990.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66346695|ref|NP_001990.2|
Domain Number 1 Region: 2378-2450
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.05e-19
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 2 Region: 994-1063
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.59e-19
Family TB module/8-cys domain 0.00065
Further Details:      
 
Domain Number 3 Region: 1729-1800
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.28e-18
Family TB module/8-cys domain 0.00043
Further Details:      
 
Domain Number 4 Region: 2093-2164
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-18
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 5 Region: 355-421
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.62e-18
Family TB module/8-cys domain 0.0018
Further Details:      
 
Domain Number 6 Region: 578-702
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.61e-18
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 7 Region: 2171-2305
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.43e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 1890-2016
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 9 Region: 209-294
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.4e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 10 Region: 2493-2621
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.34e-16
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 11 Region: 889-973
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.67e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 12 Region: 1070-1200
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000102
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 13 Region: 1569-1642
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000196
Family TB module/8-cys domain 0.0000464
Further Details:      
 
Domain Number 14 Region: 694-766
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000249
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 15 Region: 1360-1495
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000251
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 16 Region: 1453-1579
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000863
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 17 Region: 2263-2380
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000879
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 18 Region: 1648-1703
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000046
Family EGF-type module 0.00059
Further Details:      
 
Domain Number 19 Region: 2618-2734
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000022
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 20 Region: 756-898
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000392
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 21 Region: 1227-1378
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000769
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 22 Region: 2453-2498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000312
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 23 Region: 2054-2107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000139
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 24 Region: 250-367
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 25 Region: 493-586
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000361
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 26 Region: 1807-1861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family EGF-type module 0.0024
Further Details:      
 
Domain Number 27 Region: 2009-2051
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000312
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 28 Region: 1850-1888
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000723
Family EGF-type module 0.01
Further Details:      
 
Domain Number 29 Region: 1200-1232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000287
Family EGF-type module 0.0094
Further Details:      
 
Weak hits

Sequence:  gi|66346695|ref|NP_001990.2|
Domain Number - Region: 180-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00299
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 2827-2873
Classification Level Classification E-value
Superfamily Cadherin-like 0.00576
Family Cadherin 0.013
Further Details:      
 
Domain Number - Region: 146-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0681
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|66346695|ref|NP_001990.2|
Sequence length 2912
Comment fibrillin-2 precursor [Homo sapiens]
Sequence
MGRRRRLCLQLYFLWLGCVVLWAQGTAGQPQPPPPKPPRPQPPPQQVRSATAGSEGGFLA
PEYREEGAAVASRVRRRGQQDVLRGPNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCG
DGFCSRPNMCTCSSGQISSTCGSKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVC
ENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCC
ATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFE
CRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCID
QRTGMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDG
LPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGG
QGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECT
SNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQC
ICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVD
ECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFP
GAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICA
NGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPG
YVFRTETETCEDINECESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWL
NIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECE
VFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKF
RMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAF
PGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFEC
ECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD
INECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNS
EGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDM
KTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDM
HASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGF
TGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNI
CVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPP
DFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCET
CPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQG
YYLSEDTRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFC
YRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFD
IHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNL
CQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICH
NGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSF
FGQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFR
CICPPGYEVKSENCIDINECDEDPNICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTR
QSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHG
TVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIG
NPCGNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCP
IGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDEN
ECRTKPGICENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASS
SRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLC
TNGQCINTMGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNYICKNTEGSYQCSCPRG
YVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPS
LCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQHGCQNILGGYRCGCP
QGYIQHYQWNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECS
SSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCVSGMGFNKGQYLSLDTEVDEENALSPE
ACYECKINGYSKKDSRQKRSIHEPDPTAVEQISLESVDMDSPVNMKFNLSHLGSKEHILE
LRPAIQPLNNHIRYVISQGNDDSVFRIHQRNGLSYLHTAKKKLMPGTYTLEITSIPLYKK
KELKKLEESNEDDYLLGELGEALRMRLQIQLY
Download sequence
Identical sequences P35556
NP_001990.2.87134 NP_001990.2.92137 9606.ENSP00000262464 ENSP00000262464 ENSP00000424571 ENSP00000262464 ENSP00000424571 ENSP00000262464 gi|66346695|ref|NP_001990.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]