SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|66346733|ref|NP_001280.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66346733|ref|NP_001280.3|
Domain Number 1 Region: 98-239
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.81e-35
Family SCOPe 0.00014
Further Details:      
 
Domain Number 2 Region: 25-97
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.06e-27
Family SCOPe 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|66346733|ref|NP_001280.3|
Sequence length 247
Comment chloride intracellular channel protein 2 [Homo sapiens]
Sequence
MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEE
LKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKF
SAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLT
LADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYA
NVAKQKS
Download sequence
Identical sequences G3S4N2 H2R4G9 O15247
NP_001280.3.87134 NP_001280.3.92137 XP_001144952.1.37143 XP_003809997.1.60992 XP_004065221.2.27298 XP_016800126.1.37143 gi|66346733|ref|NP_001280.3| ENSGGOP00000023035 ENSP00000358460 ENSP00000469202 ENSPTRP00000047195 ENSP00000318558 ENSGGOP00000023035 ENSPTRP00000047195 ENSP00000358460 2r4v_A 2r5g_A 9598.ENSPTRP00000047195 9606.ENSP00000358460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]