SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|66737374|ref|NP_001019384.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66737374|ref|NP_001019384.1|
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily EF-hand 8.94e-19
Family S100 proteins 0.000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|66737374|ref|NP_001019384.1|
Sequence length 98
Comment protein S100-A13 [Homo sapiens]
Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKM
KSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Download sequence
Identical sequences G3RL57 H2R8L4 Q99584
ENSP00000344822 ENSP00000357688 ENSP00000376398 ENSP00000376399 ENSP00000392767 CIRMMP11 gi|5174659|ref|NP_005970.1| gi|66737368|ref|NP_001019381.1| gi|66737370|ref|NP_001019382.1| gi|66737372|ref|NP_001019383.1| gi|66737374|ref|NP_001019384.1| ENSGGOP00000016495 9598.ENSPTRP00000051743 9606.ENSP00000344822 NP_001019381.1.87134 NP_001019381.1.92137 NP_001019382.1.87134 NP_001019382.1.92137 NP_001019383.1.87134 NP_001019383.1.92137 NP_001019384.1.87134 NP_001019384.1.92137 NP_005970.1.87134 NP_005970.1.92137 XP_001140557.1.37143 XP_003817209.1.60992 XP_003817210.1.60992 XP_004026801.1.27298 XP_005245491.1.92137 XP_008968594.1.60992 XP_008968596.1.60992 XP_008968597.1.60992 XP_009430566.1.37143 XP_009430575.1.37143 XP_009430581.1.37143 XP_009430584.1.37143 XP_011508164.1.92137 XP_011508165.1.92137 XP_011508166.1.92137 XP_016782980.1.37143 XP_016782997.1.37143 XP_016857523.1.92137 XP_016857524.1.92137 XP_016857525.1.92137 XP_018878432.1.27298 XP_018878435.1.27298 XP_018878441.1.27298 XP_018878444.1.27298 XP_018878450.1.27298 XP_018878452.1.27298 ENSGGOP00000016495 ENSP00000344822 1yutA ENSP00000344822 ENSP00000357688 ENSP00000376398 ENSP00000376399 ENSP00000392767 ENSPTRP00000051743 1yur_A 1yur_B 1yus_A 1yus_B 1yut_A 1yut_B 1yuu_A 1yuu_B 2egd_A 2egd_B 2k8m_B 2k8m_C 2ki4_B 2ki4_C 2ki6_C 2ki6_D 2kot_A 2kot_B 2l5x_B 2l5x_C ENSPTRP00000051743 000003145|e1yutA1|108.1.1.28|A:1-98 000048953|e1yuuB1|108.1.1.28|B:1-98 000048954|e1yusB1|108.1.1.28|B:1-98 000048955|e1yuuA1|108.1.1.28|A:1-98 000048956|e1yurA1|108.1.1.28|A:1-98 000048957|e1yusA1|108.1.1.28|A:1-98 000048958|e1yurB1|108.1.1.28|B:1-98 000048959|e1yutB1|108.1.1.28|B:1-98 000134039|e2k8mB1|108.1.1.28|B:1-98 000359375|e2k8mC1|108.1.1.28|C:1-98 000386188|e2kotA1|108.1.1.28|A:1-98 000386189|e2kotB1|108.1.1.28|B:1-98 000410971|e2l5xB1|108.1.1.28|B:1-98 000410972|e2l5xC1|108.1.1.28|C:1-98 cath|current|1yurA00/1-98 cath|current|1yurB00/1-98 cath|current|1yusA00/1-98 cath|current|1yusB00/1-98 cath|current|1yutA00/1-98 cath|current|1yutB00/1-98 cath|current|1yuuA00/1-98 cath|current|1yuuB00/1-98 d1yura1 d1yurb_ d1yusa_ d1yusb_ d1yuta_ d1yutb_ d1yuua_ d1yuub_ d2k8mb_ d2k8mc_ d2ki4b_ d2ki4c_ d2ki6c_ d2ki6d_ d2kota_ d2kotb_ d2l5xb_ d2l5xc_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]