SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|66932986|ref|NP_001019386.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66932986|ref|NP_001019386.1|
Domain Number 1 Region: 211-272
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000153
Family LIM domain 0.0078
Further Details:      
 
Domain Number 2 Region: 268-297
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000965
Family LIM domain 0.018
Further Details:      
 
Weak hits

Sequence:  gi|66932986|ref|NP_001019386.1|
Domain Number - Region: 180-209
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00123
Family LIM domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|66932986|ref|NP_001019386.1|
Sequence length 374
Comment filamin-binding LIM protein 1 isoform b [Homo sapiens]
Sequence
MASKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRP
SPWTTPGRAAATVPAAPMQLFNGGCPPPPPVLDGEDVLPDLDLLPPPPPPPPVLLPSEEE
APAPMGASLIADLEQLHLSPPPPPPQAPAEGPSVQPGPLRPMEEELPPPPAEPVEKGAST
DICAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQSFYQKDGRPLCEPCYQDTL
ERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRYEK
GLCTGWGAGTGRDPSRVKELSLSPGCWARVSCLLVYYKEYYRAGLGAVAHACNPSTLGGR
GGWITRSGDRDHPG
Download sequence
Identical sequences gi|66932986|ref|NP_001019386.1| ENSP00000416387 NP_001019386.1.87134 NP_001019386.1.92137 XP_005245957.1.92137 XP_005245958.1.92137 XP_005245959.1.92137 XP_005245960.1.92137 XP_006710767.1.92137 XP_006710768.1.92137 XP_011539918.1.92137 XP_016857008.1.92137 XP_016857009.1.92137 XP_016857010.1.92137 XP_016857011.1.92137 XP_016857012.1.92137 XP_016857013.1.92137 ENSP00000422862 9606.ENSP00000416387 ENSP00000416387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]