SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|6715602|ref|NP_003987.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|6715602|ref|NP_003987.2|
Domain Number 1 Region: 39-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000146
Family Glutathione peroxidase-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|6715602|ref|NP_003987.2|
Sequence length 100
Comment epididymal secretory glutathione peroxidase isoform 2 precursor [Homo sapiens]
Sequence
MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYV
GKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM
Download sequence
Identical sequences H2R7I9
gi|6715602|ref|NP_003987.2| ENSP00000419935 ENSP00000449271 ENSP00000419935 ENSP00000449271 NP_001243159.1.37143 NP_003987.2.87134 NP_003987.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]