SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67189007|ref|NP_001018016.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67189007|ref|NP_001018016.1|
Domain Number 1 Region: 62-155
Classification Level Classification E-value
Superfamily SEA domain 1.1e-18
Family SEA domain 0.0088
Further Details:      
 
Weak hits

Sequence:  gi|67189007|ref|NP_001018016.1|
Domain Number - Region: 154-188
Classification Level Classification E-value
Superfamily Photosystem II 10 kDa phosphoprotein PsbH 0.0615
Family PsbH-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|67189007|ref|NP_001018016.1|
Sequence length 264
Comment mucin-1 isoform 2 precursor [Homo sapiens]
Sequence
MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEK
NAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGT
INVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLV
ALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEK
VSAGNGGSSLSYTNPAVAATSANL
Download sequence
Identical sequences ENSP00000357377 gi|67189007|ref|NP_001018016.1| NP_001018016.1.87134 NP_001018016.1.92137 ENSP00000357377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]