SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|6912388|ref|NP_036330.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|6912388|ref|NP_036330.1|
Domain Number 1 Region: 54-215
Classification Level Classification E-value
Superfamily EF-hand 5.83e-42
Family Penta-EF-hand proteins 0.0000000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|6912388|ref|NP_036330.1|
Sequence length 217
Comment grancalcin [Homo sapiens]
Sequence
MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSA
VAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAA
LNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVA
CCVKLRALTDFFRKRDHLQQGSANFIYDDFLQGTMAI
Download sequence
Identical sequences P28676
ENSP00000394842 ENSP00000393218 ENSP00000394842 9606.ENSP00000394842 gi|6912388|ref|NP_036330.1| NP_036330.1.87134 NP_036330.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]