SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|6912494|ref|NP_036457.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|6912494|ref|NP_036457.1|
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.62e-51
Family Calponin-homology domain, CH-domain 0.00000037
Further Details:      
 
Domain Number 2 Region: 195-261
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 3.07e-45
Family EB1 dimerisation domain-like 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|6912494|ref|NP_036457.1|
Sequence length 268
Comment microtubule-associated protein RP/EB family member 1 [Homo sapiens]
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKK
VKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVV
RKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQ
RIVDILYATDEGFVIPDEGGPQEEQEEY
Download sequence
Identical sequences K7ARF5 Q15691
2r8uA ENSP00000364721 9606.ENSP00000364721 ENSP00000364721 NP_036457.1.87134 NP_036457.1.92137 XP_003814782.1.60992 XP_011526998.1.92137 XP_016793186.1.37143 XP_016793187.1.37143 XP_016793188.1.37143 gi|6912494|ref|NP_036457.1| 2r8u_A 2r8u_B Q15691 ENSP00000364721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]