SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|6912568|ref|NP_036516.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|6912568|ref|NP_036516.1|
Domain Number 1 Region: 89-176
Classification Level Classification E-value
Superfamily SAND domain-like 4.19e-30
Family SAND domain 0.00000974
Further Details:      
 
Weak hits

Sequence:  gi|6912568|ref|NP_036516.1|
Domain Number - Region: 248-344
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0561
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|6912568|ref|NP_036516.1|
Sequence length 530
Comment glucocorticoid modulatory element-binding protein 2 [Homo sapiens]
Sequence
MATPDVSVHMEEVVVVTTPDTAVDGSGVEGVKTVLVTTNLAPHGGDLTEDNMETENAAAA
AAAAFTASSQLKEAVLVKMAEEGENLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQY
DEHVISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELDFYQHDKVCSNTCRSTKI
DLSGARVSLSSPTSAEYIPLTPAAADVNGSPATITIETCEDPGDWTAAIGDDTFTFWRGL
KDAGLLDEVIQEFHQELVETMRGLQQRVQDPPLQLRDAVLLNNIVQNFGMLDLVKKVLAS
HKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPVSLPPPVKRPR
LARATSGPAAMASQVLTQSAQLALGPGVPVPQLTSVPLGKVVSTLPSTVLGKGSLQAPPA
SSPASPLLGGYTVLASSGSTYPSTVEIHPDASSLTVLSTAAVQDGSTVFKVVSPLQLLTL
PGLGPTLQNVAQASPGSSTIVTVPAGAAPGPEEHTATIEVAAMAEDHERK
Download sequence
Identical sequences Q9UKD1
ENSP00000266068 ENSP00000359094 GO.34896 gi|6912568|ref|NP_036516.1| ENSP00000266068 ENSP00000359094 9606.ENSP00000266068 NP_036516.1.87134 NP_036516.1.92137 XP_005260259.1.92137 ENSP00000266068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]