SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|6912582|ref|NP_036524.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|6912582|ref|NP_036524.1|
Domain Number 1 Region: 114-279
Classification Level Classification E-value
Superfamily EF-hand 3.23e-44
Family Penta-EF-hand proteins 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|6912582|ref|NP_036524.1|
Sequence length 284
Comment peflin [Homo sapiens]
Sequence
MASYPYRQGCPGAAGQAPGAPPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAG
GGPYGHPNPGMFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAY
SWFQSVDSDHSGYISMKELKQALVNCNWSSFNDETCLMMINMFDKTKSGRIDVYGFSALW
KFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRYCPRSANPAMQL
DRFIQVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML
Download sequence
Identical sequences G1QND9 H2PYJ2 Q9UBV8
NP_036524.1.87134 NP_036524.1.92137 XP_003276401.1.23891 XP_513269.2.37143 ENSP00000362807 gi|6912582|ref|NP_036524.1| ENSNLEP00000002455 ENSP00000362807 ENSNLEP00000002455 ENSP00000362807 ENSPTRP00000000805 ENSPTRP00000000805 9598.ENSPTRP00000000805 9606.ENSP00000362807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]