SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|6912590|ref|NP_036528.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|6912590|ref|NP_036528.1|
Domain Number 1 Region: 7-88
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000179
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|6912590|ref|NP_036528.1|
Sequence length 127
Comment pleckstrin homology-like domain family A member 3 [Homo sapiens]
Sequence
MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKA
VECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSL
GTGTLVS
Download sequence
Identical sequences A0A096MLM2 A0A0D9SA54 A0A2I2ZJ10 A0A2I3HCX9 A0A2I3T3Y0 A0A2K5C085 A0A2K5HAB4 A0A2K5KT48 A0A2K5P8W6 A0A2K5UJ96 A0A2K5XQ53 A0A2K6ANC5 A0A2K6K2R2 A0A2K6NMW0 A0A2K6S1N4 H2N476 H9EPX0 Q9Y5J5 U3CYA7
ENSGGOP00000004739 ENSPPYP00000000407 ENSPTRP00000003070 ENSPPYP00000000407 ENSP00000356278 ENSP00000356280 ENSP00000356278 ENSP00000356280 GO.33796 GO.56058 HR2080 hsi002012626.1 ENSPTRP00000003070 ENSGGOP00000004739 gi|6912590|ref|NP_036528.1| ENSNLEP00000021967 ENSPANP00000000451 NP_036528.1.87134 NP_036528.1.92137 XP_002809664.1.23681 XP_003264591.1.23891 XP_003308734.1.37143 XP_003823077.1.60992 XP_003938319.1.74449 XP_004088981.1.23891 XP_004088982.1.23891 XP_005540459.1.63531 XP_007987161.1.81039 XP_010377172.1.97406 XP_011744880.1.29376 XP_011744881.1.29376 XP_011787134.1.43180 XP_011787135.1.43180 XP_011787136.1.43180 XP_011845936.1.47321 XP_011845937.1.47321 XP_011845938.1.47321 XP_011892382.1.92194 XP_011892386.1.92194 XP_012314932.1.9421 XP_012357446.1.23891 XP_015303414.1.63531 XP_017354932.1.71028 XP_017751971.1.44346 XP_018884199.1.27298 9598.ENSPTRP00000003070 9600.ENSPPYP00000000407 9606.ENSP00000356278 ENSP00000356278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]