SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|6912638|ref|NP_036557.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|6912638|ref|NP_036557.1|
Domain Number 1 Region: 19-222
Classification Level Classification E-value
Superfamily L domain-like 7.94e-43
Family Ngr ectodomain-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|6912638|ref|NP_036557.1|
Sequence length 277
Comment ras suppressor protein 1 isoform 1 [Homo sapiens]
Sequence
MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMVPPNIA
ELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNN
LSENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELT
QLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSE
TYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR
Download sequence
Identical sequences A0A2K5XY92 Q15404
ENSP00000339521 ENSP00000367154 ENSP00000339521 NP_036557.1.87134 NP_036557.1.92137 XP_011823493.1.47321 XP_011823494.1.47321 9606.ENSP00000339521 GO.39735 gi|6912638|ref|NP_036557.1| ENSP00000339521 ENSP00000367154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]