SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7019381|ref|NP_037363.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7019381|ref|NP_037363.1|
Domain Number 1 Region: 80-360
Classification Level Classification E-value
Superfamily L domain-like 1.02e-52
Family Ngr ectodomain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 417-496
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000189
Family Fibronectin type III 0.0027
Further Details:      
 
Weak hits

Sequence:  gi|7019381|ref|NP_037363.1|
Domain Number - Region: 34-78
Classification Level Classification E-value
Superfamily L domain-like 0.000204
Family Ngr ectodomain-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7019381|ref|NP_037363.1|
Sequence length 660
Comment leucine-rich repeat transmembrane protein FLRT2 precursor [Homo sapiens]
Sequence
MGLQTTKWPSHGAFFLKSWLIISLGLYSQVSKLLACPSVCRCDRNFVYCNERSLTSVPLG
IPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENN
IQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPV
DLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKGIAEGTFSHLTKLKEFSIVRN
SLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRMLTQGVFDNLS
NLKQLTARNNPWFCDCSIKWVTEWLKYIPSSLNVRGFMCQGPEQVRGMAVRELNMNLLSC
PTTTPGLPLFTPAPSTASPTTQPPTLSIPNPSRSYTPPTPTTSKLPTIPDWDGRERVTPP
ISERIQLSIHFVNDTSIQVSWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSL
VNLEPRSTYRICLVPLDAFNYRAVEDTICSEATTHASYLNNGSNTASSHEQTTSHSMGSP
FLLAGLIGGAVIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSIL
EMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT
Download sequence
Identical sequences O43155
ENSP00000332879 ENSP00000451050 ENSP00000332879 NP_037363.1.87134 NP_037363.1.92137 XP_005267547.1.92137 XP_011534913.1.92137 XP_016876618.1.92137 XP_016876619.1.92137 XP_016876620.1.92137 XP_016876621.1.92137 XP_016876622.1.92137 XP_016876623.1.92137 XP_016876624.1.92137 gi|7019381|ref|NP_037363.1| ENSP00000332879 ENSP00000451050 9606.ENSP00000332879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]