SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7019383|ref|NP_037413.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7019383|ref|NP_037413.1|
Domain Number 1 Region: 75-355
Classification Level Classification E-value
Superfamily L domain-like 1.02e-50
Family Ngr ectodomain-like 0.002
Further Details:      
 
Domain Number 2 Region: 31-94
Classification Level Classification E-value
Superfamily L domain-like 0.00000918
Family Ngr ectodomain-like 0.0085
Further Details:      
 
Domain Number 3 Region: 411-480
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000515
Family Fibronectin type III 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|7019383|ref|NP_037413.1|
Sequence length 649
Comment leucine-rich repeat transmembrane protein FLRT3 precursor [Homo sapiens]
Sequence
MISAAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDA
TTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTIT
YDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEEL
RLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAA
PVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQL
ILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNAELFDCKDSGI
VSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPSRKTITITVKSVTS
DTIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVTALEPDSPYKVCMV
PMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALV
TIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPIS
NEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS
Download sequence
Identical sequences Q9NZU0
ENSP00000339912 ENSP00000367292 NP_037413.1.87134 NP_037413.1.92137 NP_938205.1.87134 NP_938205.1.92137 XP_003810633.1.60992 XP_003810634.1.60992 XP_005260739.1.92137 XP_008961165.1.60992 XP_011527506.1.92137 XP_011527507.1.92137 gi|38202222|ref|NP_938205.1| gi|7019383|ref|NP_037413.1| ENSP00000339912 ENSP00000367292 ENSP00000339912 ENSPTRP00000022750 9598.ENSPTRP00000022750 9606.ENSP00000339912 ENSPTRP00000022750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]