SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7019485|ref|NP_037364.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7019485|ref|NP_037364.1|
Domain Number 1 Region: 25-187
Classification Level Classification E-value
Superfamily EF-hand 2.5e-47
Family Penta-EF-hand proteins 0.000000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|7019485|ref|NP_037364.1|
Sequence length 191
Comment programmed cell death protein 6 [Homo sapiens]
Sequence
MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPF
NPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALS
GFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSY
EQYLSMVFSIV
Download sequence
Identical sequences A0A2I2ZVB3 A0A2I3LEX2 A0A2K5VCV5 A0A2K6LEA4 H2PF20 H9EN72 O75340
ENSP00000264933 9600.ENSPPYP00000017091 gi|7019485|ref|NP_037364.1| ENSP00000264933 ENSP00000264933 ENSPPYP00000017091 NP_037364.1.87134 NP_037364.1.92137 XP_004059146.2.27298 XP_014995160.1.72884 XP_017723843.1.44346 CIRMMP39 ENSPPYP00000017091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]