SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7019505|ref|NP_037517.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7019505|ref|NP_037517.1|
Domain Number 1 Region: 59-251
Classification Level Classification E-value
Superfamily Sec7 domain 7.98e-77
Family Sec7 domain 0.000000046
Further Details:      
 
Domain Number 2 Region: 259-380
Classification Level Classification E-value
Superfamily PH domain-like 8.04e-33
Family Pleckstrin-homology domain (PH domain) 0.00000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7019505|ref|NP_037517.1|
Sequence length 394
Comment cytohesin-4 [Homo sapiens]
Sequence
MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQ
KEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDP
INLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNPGVFQ
STDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSDLPEDQLRNLFDSIKS
EPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPR
GIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSA
EERDQWIESIRASITRVPFYDLVSTRKKKIASKQ
Download sequence
Identical sequences Q9UIA0
NP_037517.1.87134 NP_037517.1.92137 ENSP00000248901 gi|7019505|ref|NP_037517.1| ENSP00000384280 9606.ENSP00000248901 ENSP00000248901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]