SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71051598|ref|NP_057159.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71051598|ref|NP_057159.2|
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily PH domain-like 4.51e-39
Family VPS36 N-terminal domain-like 0.000000299
Further Details:      
 
Domain Number 2 Region: 277-385
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.98e-29
Family MarR-like transcriptional regulators 0.073
Further Details:      
 
Domain Number 3 Region: 189-311
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000141
Family Vacuolar sorting protein domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71051598|ref|NP_057159.2|
Sequence length 386
Comment vacuolar protein-sorting-associated protein 36 [Homo sapiens]
Sequence
MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMA
ILLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYR
RLSEEMTQRRWENMPVSQSLQTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFED
LSKLMIKAKEMVELSKSIANKIKDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQ
YHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLP
LRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLA
EKMGHLCRDDSVEGLRFYPNLFMTQS
Download sequence
Identical sequences A0A2J8SSK1 G3QYH7 H2Q7L7 Q86VN1
9598.ENSPTRP00000010034 9606.ENSP00000367299 ENSP00000367299 ENSP00000367299 ENSPTRP00000010034 GO.37144 gi|71051598|ref|NP_057159.2| ENSP00000367299 ENSPTRP00000010034 ENSGGOP00000007913 ENSGGOP00000007913 NP_057159.2.87134 NP_057159.2.92137 XP_004054603.1.27298 XP_509796.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]