SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71067341|ref|NP_001025006.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|71067341|ref|NP_001025006.1|
Domain Number - Region: 88-244
Classification Level Classification E-value
Superfamily PH domain-like 0.00016
Family Phosphotyrosine-binding domain (PTB) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71067341|ref|NP_001025006.1|
Sequence length 465
Comment malcavernin isoform 1 [Homo sapiens]
Sequence
MHSSCRQRRNQNLSKEIPQTEFHTGYSMENEPGIVSPFKRVFLKGEKSRDKKAHEKVTER
RPLHTVVLSLPERVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAH
QLPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVVLKTAQ
DPGISPSQSLCAESSRGLSAGSLSESAVGPVEACCLVILAAESKVAAEELCCLLGQVFQV
VYTESTIDFLDRAIFDGASTPTHHLSLHSDDSSTKVDIKETYEVEASTFCFPESVDVGGA
SPHSKTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLR
QLYGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSST
TNGNRATGSSDDRSAPSEGDEWDRMISDISSDIEALGCSMDQDSA
Download sequence
Identical sequences ENSP00000370503 gi|71067341|ref|NP_001025006.1| 9606.ENSP00000370503 NP_001025006.1.87134 NP_001025006.1.92137 ENSP00000419474 ENSP00000370503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]