SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71274156|ref|NP_001025052.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71274156|ref|NP_001025052.1|
Domain Number 1 Region: 1-183
Classification Level Classification E-value
Superfamily EF-hand 2.09e-28
Family Calmodulin-like 0.0000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71274156|ref|NP_001025052.1|
Sequence length 185
Comment calcium and integrin-binding family member 4 [Homo sapiens]
Sequence
MGQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPA
LRVNPFRDRICRVFSHKGMFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEE
DLQRIILRLLNSDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRI
HFWGC
Download sequence
Identical sequences A0PJX0
NP_001025052.1.87134 NP_001025052.1.92137 gi|71274156|ref|NP_001025052.1| 9606.ENSP00000288861 ENSP00000288861 ENSP00000288861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]