SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71896667|ref|NP_001010852.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71896667|ref|NP_001010852.2|
Domain Number 1 Region: 97-268
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 5.62e-52
Family CRAL/TRIO domain 0.000028
Further Details:      
 
Domain Number 2 Region: 6-82
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.03e-17
Family CRAL/TRIO N-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71896667|ref|NP_001010852.2|
Sequence length 327
Comment clavesin-2 [Homo sapiens]
Sequence
MTHLQAGLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRA
RKFHHFEAFRLLAQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILV
LFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSML
RLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLI
HPEILPSEFGGMLPPYDMGTWARTLLDHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRS
QSVVDPTVLKRMDKNEEENMQPLLSLD
Download sequence
Identical sequences A0A096MV83 A0A0D9RUR6 A0A2K5LQS4 A0A2K5YT24 A0A2K6CGF4 A0A2K6EQD8 A0A2K6MJS9 A0A2K6NE31 F1PL15 F6ZKU2 F7EDV5 G1RUB2 G3SAF3 G3T080 G7P389 H2PK87 H2QTP1 I3LYK8 M3WE10 Q5SYC1 Q95KF7 S7P641 W5PE39
ENSPTRP00000031696 ENSECAP00000004501 ENSMMUP00000023901 ENSPVAP00000005321 ENSP00000275162 ENSP00000275162 ENSLAFP00000006347 ENSGGOP00000025076 ENSECAP00000004501 ENSOARP00000008703 ENSTTRP00000010185 ENSPVAP00000005321 gi|71896667|ref|NP_001010852.2| ENSPPYP00000019011 ENSNLEP00000016837 ENSTTRP00000010185 ENSPTRP00000031696 ENSGGOP00000025076 ENSSTOP00000001289 ENSNLEP00000016837 ENSCAFP00000001426 ENSPANP00000003758 ENSLAFP00000006347 ENSVPAP00000008742 ENSP00000275162 ENSVPAP00000008742 9544.ENSMMUP00000023901 9598.ENSPTRP00000031696 9600.ENSPPYP00000019011 9606.ENSP00000275162 9796.ENSECAP00000004501 ENSPPYP00000019011 ENSCAFP00000001426 ENSMMUP00000023901 NP_001010852.2.87134 NP_001010852.2.92137 NP_001181324.1.72884 XP_001504263.1.31192 XP_002919735.1.58354 XP_003255699.1.23891 XP_003404288.1.64505 XP_003827649.1.60992 XP_004011199.1.66739 XP_004263911.1.21590 XP_004382781.1.4749 XP_004422336.1.5094 XP_005340578.1.77405 XP_005551772.1.63531 XP_005859009.1.60319 XP_005859010.1.60319 XP_005859011.1.60319 XP_006089290.1.53796 XP_006189633.1.101512 XP_006200176.1.17985 XP_006778499.1.95426 XP_006926199.1.64745 XP_006932035.1.62641 XP_007078730.1.5354 XP_007446109.1.90284 XP_007953686.1.48129 XP_008005370.1.81039 XP_008136930.1.99482 XP_008526743.1.77740 XP_008689363.1.72690 XP_010373707.1.97406 XP_010963803.1.22495 XP_010963804.1.22495 XP_010977481.1.51371 XP_010977482.1.51371 XP_011357064.1.92234 XP_011712290.1.29376 XP_011847548.1.47321 XP_011887025.1.92194 XP_011982075.1.54773 XP_011982076.1.54773 XP_012037877.1.66739 XP_012391880.1.21590 XP_012499264.1.63892 XP_012578387.1.23501 XP_012578388.1.23501 XP_012632977.1.48125 XP_013968967.1.84170 XP_014311732.1.53796 XP_014389249.1.60319 XP_014418859.1.101512 XP_014708421.1.49734 XP_014923748.1.86478 XP_014992792.1.72884 XP_015091332.1.17985 XP_015413324.1.95426 XP_016009551.1.101085 XP_016865755.1.92137 XP_017737435.1.44346 XP_018885788.1.27298 XP_019273786.1.44245 XP_019273787.1.44245 XP_019486350.1.44202 XP_019486351.1.44202 XP_019486352.1.44202 XP_019596529.1.88060 XP_019596531.1.88060 XP_019596532.1.88060 XP_019655699.1.58354 XP_019655700.1.58354 XP_019686723.1.62641 XP_019807473.1.83887 XP_019807474.1.83887 XP_021549238.1.83697 XP_021576054.1.77405 XP_021576055.1.77405 XP_527496.1.37143 XP_541226.2.84170 ENSSTOP00000001289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]