SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71979663|ref|NP_004481.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71979663|ref|NP_004481.2|
Domain Number 1 Region: 426-537
Classification Level Classification E-value
Superfamily SH2 domain 1.13e-32
Family SH2 domain 0.00000496
Further Details:      
 
Domain Number 2 Region: 102-198
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.79e-30
Family Ras-binding domain, RBD 0.00034
Further Details:      
 
Domain Number 3 Region: 229-343
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000145
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71979663|ref|NP_004481.2|
Sequence length 540
Comment growth factor receptor-bound protein 14 [Homo sapiens]
Sequence
MTTSLQDGQSAASRAAARDSPLAAQVCGAAQGRGDAHDLAPAPWLHARALLPLPDGTRGC
AADRRKKKDLDVPEMPSIPNPFPELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSR
ALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIE
EENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLSSSTYPEIHGF
LHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDIYVSLAGKKKHGA
PTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGC
SSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSP
TASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMS
HGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL
Download sequence
Identical sequences H2QIW7 Q14449
NP_004481.2.87134 NP_004481.2.92137 XP_515864.3.37143 gi|71979663|ref|NP_004481.2| 9606.ENSP00000263915 ENSP00000263915 HR3144 ENSP00000263915 ENSP00000263915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]