SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7305199|ref|NP_038462.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7305199|ref|NP_038462.1|
Domain Number 1 Region: 75-252
Classification Level Classification E-value
Superfamily EF-hand 3.69e-49
Family Calmodulin-like 0.000000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|7305199|ref|NP_038462.1|
Sequence length 256
Comment calsenilin isoform 1 [Homo sapiens]
Sequence
MQPAKEVTKASDGSLLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGS
DSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQ
FFPQGDATTYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDG
YITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQ
KDENIMSSMQLFENVI
Download sequence
Identical sequences A0A024RE22 Q9Y2W7
gi|7305199|ref|NP_038462.1| 9606.ENSP00000295225 ENSP00000295225 ENSP00000295225 ENSP00000295225 HR2970 NP_038462.1.87134 NP_038462.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]