SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73623026|ref|NP_001027019.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73623026|ref|NP_001027019.1|
Domain Number 1 Region: 24-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-34
Family Spermadhesin, CUB domain 0.0000146
Further Details:      
 
Domain Number 2 Region: 184-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-32
Family Spermadhesin, CUB domain 0.0000266
Further Details:      
 
Domain Number 3 Region: 300-363
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000278
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000729
Family EGF-type module 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73623026|ref|NP_001027019.1|
Sequence length 380
Comment mannan-binding lectin serine protease 1 isoform 3 precursor [Homo sapiens]
Sequence
MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKL
YFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRS
DFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRT
CRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEV
PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNE
CPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIP
TCKKNEIDLESELKSEQVTE
Download sequence
Identical sequences NP_001027019.1.87134 NP_001027019.1.92137 ENSP00000169293 ENSP00000169293 gi|73623026|ref|NP_001027019.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]