SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|74027255|ref|NP_001027555.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|74027255|ref|NP_001027555.1|
Domain Number 1 Region: 45-81
Classification Level Classification E-value
Superfamily WW domain 0.0000000378
Family WW domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|74027255|ref|NP_001027555.1|
Sequence length 265
Comment polyglutamine-binding protein 1 isoform 1 [Homo sapiens]
Sequence
MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSC
GLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRS
HEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHR
REELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLF
QQRPYPSPGAVLRANAEASRTKQQD
Download sequence
Identical sequences A0A0S2Z4V5 A1YFA7 H2QYK3 O60828
ENSGGOP00000011148 ENSPTRP00000037555 gi|5031957|ref|NP_005701.1| gi|74027247|ref|NP_001027553.1| gi|74027253|ref|NP_001027554.1| gi|74027255|ref|NP_001027555.1| gi|74027257|ref|NP_001027556.1| ENSP00000218224 ENSP00000218224 ENSP00000365747 ENSP00000379985 ENSP00000391759 GO.40575 ENSPTRP00000037555 9598.ENSPTRP00000037555 9606.ENSP00000365747 NP_001027553.1.87134 NP_001027553.1.92137 NP_001027554.1.87134 NP_001027554.1.92137 NP_001027555.1.87134 NP_001027555.1.92137 NP_001027556.1.87134 NP_001027556.1.92137 NP_005701.1.87134 NP_005701.1.92137 XP_001140800.2.37143 XP_003807276.1.60992 XP_004064161.1.27298 XP_004064163.1.27298 XP_008957543.1.60992 XP_008957544.1.60992 XP_009437317.1.37143 XP_009437318.1.37143 XP_009437319.1.37143 XP_011542186.1.92137 XP_018874785.1.27298 XP_018874786.1.27298 XP_018874787.1.27298 ENSGGOP00000011148 ENSP00000218224 ENSP00000365747 ENSP00000379985 ENSP00000391759 ENSP00000469772 ENSP00000471461 ENSP00000472009 ENSP00000472506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]