SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|74027261|ref|NP_006837.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|74027261|ref|NP_006837.2|
Domain Number 1 Region: 629-677
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 6.79e-17
Family Serine proteinase inhibitor lekti 0.0039
Further Details:      
 
Domain Number 2 Region: 771-818
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 1.11e-16
Family Serine proteinase inhibitor lekti 0.0052
Further Details:      
 
Domain Number 3 Region: 492-540
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 3.47e-16
Family Serine proteinase inhibitor lekti 0.0064
Further Details:      
 
Domain Number 4 Region: 912-959
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 5.82e-16
Family Serine proteinase inhibitor lekti 0.016
Further Details:      
 
Domain Number 5 Region: 222-270
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 7.07e-16
Family Serine proteinase inhibitor lekti 0.0071
Further Details:      
 
Domain Number 6 Region: 562-612
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 8.18e-16
Family Serine proteinase inhibitor lekti 0.0014
Further Details:      
 
Domain Number 7 Region: 433-480
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000129
Family Serine proteinase inhibitor lekti 0.0014
Further Details:      
 
Domain Number 8 Region: 92-152
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000018
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 9 Region: 293-342
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000402
Family Serine proteinase inhibitor lekti 0.0016
Further Details:      
 
Domain Number 10 Region: 364-411
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000749
Family Serine proteinase inhibitor lekti 0.00019
Further Details:      
 
Domain Number 11 Region: 703-752
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000915
Family Serine proteinase inhibitor lekti 0.02
Further Details:      
 
Domain Number 12 Region: 158-205
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000139
Family Serine proteinase inhibitor lekti 0.0062
Further Details:      
 
Domain Number 13 Region: 846-895
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000554
Family Serine proteinase inhibitor lekti 0.0036
Further Details:      
 
Domain Number 14 Region: 992-1047
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000139
Family Ovomucoid domain III-like 0.015
Further Details:      
 
Domain Number 15 Region: 26-75
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000236
Family Serine proteinase inhibitor lekti 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|74027261|ref|NP_006837.2|
Sequence length 1064
Comment serine protease inhibitor Kazal-type 5 isoform b precursor [Homo sapiens]
Sequence
MKIATVSVLLPLALCLIQDAASKNEDQEMCHEFQAFMKNGKLFCPQDKKFFQSLDGIMFI
NKCATCKMILEKEAKSQKRARHLARAPKATAPTELNCDDFKKGERDGDFICPDYYEAVCG
TDGKTYDNRCALCAENAKTGSQIGVKSEGECKSSNPEQDVCSAFRPFVRDGRLGCTREND
PVLGPDGKTHGNKCAMCAELFLKEAENAKREGETRIRRNAEKDFCKEYEKQVRNGRLFCT
RESDPVRGPDGRMHGNKCALCAEIFKQRFSEENSKTDQNLGKAEEKTKVKREIVKLCSQY
QNQAKNGILFCTRENDPIRGPDGKMHGNLCSMCQAYFQAENEEKKKAEARARNKRESGKA
TSYAELCSEYRKLVRNGKLACTRENDPIQGPDGKVHGNTCSMCEVFFQAEEEEKKKKEGK
SRNKRQSKSTASFEELCSEYRKSRKNGRLFCTRENDPIQGPDGKMHGNTCSMCEAFFQQE
ERARAKAKREAAKEICSEFRDQVRNGTLICTREHNPVRGPDGKMHGNKCAMCASVFKLEE
EEKKNDKEEKGKVEAEKVKREAVQELCSEYRHYVRNGRLPCTRENDPIEGLDGKIHGNTC
SMCEAFFQQEAKEKERAEPRAKVKREAEKETCDEFRRLLQNGKLFCTRENDPVRGPDGKT
HGNKCAMCKAVFQKENEERKRKEEEDQRNAAGHGSSGGGGGNTQDECAEYREQMKNGRLS
CTRESDPVRDADGKSYNNQCTMCKAKLEREAERKNEYSRSRSNGTGSESGKDTCDEFRSQ
MKNGKLICTRESDPVRGPDGKTHGNKCTMCKEKLEREAAEKKKKEDEDRSNTGERSNTGE
RSNDKEDLCREFRSMQRNGKLICTRENNPVRGPYGKMHINKCAMCQSIFDREANERKKKD
EEKSSSKPSNNAKDECSEFRNYIRNNELICPRENDPVHGADGKFYTNKCYMCRAVFLTEA
LERAKLQEKPSHVRASQEEDSPDSFSSLDSEMCKDYRVLPRIGYLCPKDLKPVCGDDGQT
YNNPCMLCHENLIRQTNTHIRSTGKCEESSTPGTTAASMPPSDE
Download sequence
Identical sequences Q9NQ38
gi|74027261|ref|NP_006837.2| NP_006837.2.87134 NP_006837.2.92137 ENSP00000256084 ENSP00000256084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]