SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7549805|ref|NP_000784.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7549805|ref|NP_000784.2|
Domain Number 1 Region: 107-204
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000036
Family Thioltransferase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|7549805|ref|NP_000784.2|
Sequence length 273
Comment type II iodothyronine deiodinase isoform a [Homo sapiens]
Sequence
MGILSVDLLITLQILPVFFSNCLFLALYDSVILLKHVVLLLSRSKSTRGEWRRMLTSEGL
RCVWKSFLLDAYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASP
ERPLVVNFGSATUPPFTSQLPAFRKLVEEFSSVADFLLVYIDEAHPSDGWAIPGDSSLSF
EVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAY
LGGKGPFSYNLQEVRHWLEKNFSKRUKKTRLAG
Download sequence
Identical sequences Q92813
ENSP00000405854 ENSP00000451419 NP_000784.2.87134 NP_000784.2.92137 NP_054644.1.87134 NP_054644.1.92137 ENSP00000405854 ENSP00000451419 gi|7549803|ref|NP_054644.1| gi|7549805|ref|NP_000784.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]