SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75709200|ref|NP_002076.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75709200|ref|NP_002076.2|
Domain Number 1 Region: 40-194
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.37e-54
Family Glutathione peroxidase-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75709200|ref|NP_002076.2|
Sequence length 197
Comment phospholipid hydroperoxide glutathione peroxidase, mitochondrial isoform A precursor [Homo sapiens]
Sequence
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYR
GFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA
AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRY
GPMEEPLVIEKDLPHYF
Download sequence
Identical sequences P36969 Q4AEH2
NP_002076.2.87134 NP_002076.2.92137 XP_014197879.1.60992 gi|75709200|ref|NP_002076.2| ENSP00000346103 ENSP00000346103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]