SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75750476|ref|NP_001028738.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75750476|ref|NP_001028738.1|
Domain Number 1 Region: 2-202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.38e-32
Family G proteins 0.0027
Further Details:      
 
Domain Number 2 Region: 415-585
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.36e-25
Family G proteins 0.0089
Further Details:      
 
Domain Number 3 Region: 168-268,310-368
Classification Level Classification E-value
Superfamily EF-hand 9.28e-22
Family Calmodulin-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75750476|ref|NP_001028738.1|
Sequence length 659
Comment mitochondrial Rho GTPase 1 isoform 2 [Homo sapiens]
Sequence
MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSE
AEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKS
DLVEYSSMETILPIMNQYTEIETCVECSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKE
MKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNTPLAPQALEDVKNVVRKHISDG
VADSGLTLKGFLFLHTLFIQRGRHETTWTVLRRFGYDDDLDLTPEYLFPLLKIPPDCTTE
LNHHAYLFLQSTFDKHDLDRDCALSPDELKDLFKVFPYIPWGPDVNNTVCTNERGWITYQ
GFLSQWTLTTYLDVQRCLEYLGYLGYSILTEQESQASAVTVTRDKKIDLQKKQTQRNVFR
CNVIGVKNCGKSGVLQALLGRNLMRQKKIREDHKSYYAINTVYVYGQEKYLLLHDISESE
FLTEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSI
SPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYPHARLRCMCTCNRCTFCICQN
FLNSDLLQSVKNKIFTAVLNRHVTQADLKSSTFWLRASFGATVFAVLGFAMYKALLKQR
Download sequence
Identical sequences gi|75750476|ref|NP_001028738.1| ENSP00000439737 ENSP00000439737 NP_001028738.1.87134 NP_001028738.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]