SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7657232|ref|NP_055086.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7657232|ref|NP_055086.1|
Domain Number 1 Region: 395-561
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.49e-27
Family Toll/Interleukin receptor TIR domain 0.00073
Further Details:      
 
Domain Number 2 Region: 252-349
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000113
Family I set domains 0.04
Further Details:      
 
Domain Number 3 Region: 161-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000789
Family I set domains 0.033
Further Details:      
 
Domain Number 4 Region: 38-137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000219
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|7657232|ref|NP_055086.1|
Sequence length 696
Comment interleukin-1 receptor accessory protein-like 1 precursor [Homo sapiens]
Sequence
MKAPIPHLILLYATFTQSLKVVTKRGSADGCTDWSIDIKKYQVLVGEPVRIKCALFYGYI
RTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVI
RNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEIL
WYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDK
PPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWE
SDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYTVEL
AGGLGAILLLLVCLVTIYKCYKIEIMLFYRNHFGAEELDGDNKDYDAYLSYTKVDPDQWN
QETGEEERFALEILPDMLEKHYGYKLFIPDRDLIPTGTYIEDVARCVDQSKRLIIVMTPN
YVVRRGWSIFELETRLRNMLVTGEIKVILIECSELRGIMNYQEVEALKHTIKLLTVIKWH
GPKCNKLNSKFWKRLQYEMPFKRIEPITHEQALDVSEQGPFGELQTVSAISMAAATSTAL
ATAHPDLRSTFHNTYHSQMRQKHYYRSYEYDVPPTGTLPLTSIGNQHTYCNIPMTLINGQ
RPQTKSSREQNPDEAHTNSAILPLLPRETSISSVIW
Download sequence
Identical sequences A0A2J8L3A8 G1RGF4 G3QKJ0 P60029 Q9NZN1 X5DNQ7
NYSGRC-IgSF-IRPL1_HUMAN NP_001009038.1.37143 NP_055086.1.87134 NP_055086.1.92137 XP_003261220.1.23891 XP_009437156.1.37143 XP_016884729.1.92137 XP_018875345.1.27298 XP_018875346.1.27298 9598.ENSPTRP00000037316 9606.ENSP00000305200 ENSP00000305200 ENSP00000305200 ENSP00000368278 gi|7657232|ref|NP_055086.1| ENSP00000368278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]