SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7657247|ref|NP_055407.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7657247|ref|NP_055407.1|
Domain Number 1 Region: 39-213
Classification Level Classification E-value
Superfamily EF-hand 2.04e-47
Family Calmodulin-like 0.0000000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|7657247|ref|NP_055407.1|
Sequence length 216
Comment Kv channel-interacting protein 1 isoform 2 [Homo sapiens]
Sequence
MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGF
KNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLR
GTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQ
KMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
Download sequence
Identical sequences A0A0C4DFQ7 A0A2J8LXX2 A0A2J8X7B8 H9FTP3
NP_055407.1.87134 NP_055407.1.92137 XP_001150636.1.37143 XP_002816228.1.23681 XP_003273274.1.23891 XP_003810970.1.60992 XP_003936210.1.74449 XP_005558555.1.63531 XP_008013469.1.81039 XP_010363181.1.97406 XP_011738350.1.29376 XP_011803155.1.43180 XP_011824049.1.47321 XP_012316545.1.9421 XP_017403190.1.71028 XP_017704905.1.44346 ENSP00000329686 ENSP00000329686 ENSP00000375071 gi|7657247|ref|NP_055407.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]