SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7657419|ref|NP_055174.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7657419|ref|NP_055174.1|
Domain Number 1 Region: 125-324
Classification Level Classification E-value
Superfamily L domain-like 7.78e-29
Family Ngr ectodomain-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7657419|ref|NP_055174.1|
Sequence length 332
Comment opticin precursor [Homo sapiens]
Sequence
MRLLAFLSLLALVLQETGTASLPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVI
DLSNYEELTDYGDQLPEVKVTSLAPATSISPAKSTTAPGTPSSNPTMTRPTTAGLLLSSQ
PNHGLPTCLVCVCLGSSVYCDDIDLEDIPPLPRRTAYLYARFNRISRIRAEDFKGLTKLK
RIDLSNNLISSIDNDAFRLLHALQDLILPENQLEALPVLPSGIEFLDVRLNRLQSSGIQP
AAFRAMEKLQFLYLSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQ
LEDIRLDGNPINLSLFPSAYFCLPRLPIGRFT
Download sequence
Identical sequences Q9UBM4
ENSP00000356191 9606.ENSP00000356191 NP_055174.1.87134 NP_055174.1.92137 XP_011507708.1.92137 NYSGRC-7657419 gi|7657419|ref|NP_055174.1| ENSP00000356191 ENSP00000356191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]