SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7657532|ref|NP_055439.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7657532|ref|NP_055439.1|
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily EF-hand 2.41e-19
Family S100 proteins 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7657532|ref|NP_055439.1|
Sequence length 90
Comment protein S100-A6 [Homo sapiens]
Sequence
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDL
DRNKDQEVNFQEYVTFLGALALIYNEALKG
Download sequence
Identical sequences A0A096N997 A0A0D9S5P1 A0A2K5K3X7 A0A2K5MY72 A0A2K5XUZ9 A0A2K6BM97 A0A2K6JS63 A0A2K6NAE5 F7DI51 G1RHF5 G3QWD2 G7NUG4 H2N5P2 H2Q031 P06703
ENSP00000357708 gi|7657532|ref|NP_055439.1| NP_001248728.1.72884 NP_055439.1.87134 NP_055439.1.92137 XP_002810202.1.23681 XP_003259360.1.23891 XP_003308539.1.37143 XP_003817220.1.60992 XP_004026789.1.27298 XP_005541837.1.63531 XP_007975276.1.81039 XP_008968603.1.60992 XP_008968604.1.60992 XP_009242193.1.23681 XP_009430443.1.37143 XP_010363081.1.97406 XP_011767774.1.29376 XP_011783501.1.43180 XP_011783502.1.43180 XP_011783503.1.43180 XP_011783504.1.43180 XP_011783505.1.43180 XP_011783506.1.43180 XP_011783508.1.43180 XP_011823567.1.47321 XP_011823569.1.47321 XP_011823570.1.47321 XP_011823571.1.47321 XP_011823572.1.47321 XP_011823573.1.47321 XP_011823574.1.47321 XP_011931972.1.92194 XP_011931973.1.92194 XP_012366875.1.23891 XP_012366876.1.23891 XP_012366877.1.23891 XP_012366878.1.23891 XP_012366879.1.23891 XP_012366880.1.23891 XP_012366881.1.23891 XP_016857522.1.92137 XP_017713031.1.44346 XP_018878384.1.27298 XP_018878386.1.27298 ENSMMUP00000011689 ENSPPYP00000000947 ENSPTRP00000002278 1k96_A 1k9k_A 1k9k_B 1k9p_A ENSGGOP00000007088 ENSPTRP00000002278 ENSP00000357708 ENSP00000357709 ENSP00000473589 ENSMMUP00000011689 ENSNLEP00000012655 ENSPANP00000009203 1k96A ENSP00000357708 ENSP00000357709 ENSP00000473589 ENSGGOP00000007088 ENSNLEP00000012655 ENSPPYP00000000947 9544.ENSMMUP00000011689 9598.ENSPTRP00000002278 9600.ENSPPYP00000000947 9606.ENSP00000357708 cath|current|1k96A00/2-90 cath|current|1k9kA00/2-90 cath|current|1k9kB00/2-90 cath|current|1k9pA00/2-90

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]