SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7657581|ref|NP_055066.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7657581|ref|NP_055066.1|
Domain Number 1 Region: 328-603
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.96e-79
Family Mitochondrial carrier 0.0000436
Further Details:      
 
Domain Number 2 Region: 11-157
Classification Level Classification E-value
Superfamily EF-hand 1.56e-19
Family Calbindin D9K 0.074
Further Details:      
 
Domain Number 3 Region: 159-278
Classification Level Classification E-value
Superfamily EF-hand 0.0000000282
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7657581|ref|NP_055066.1|
Sequence length 675
Comment calcium-binding mitochondrial carrier protein Aralar2 isoform 2 [Homo sapiens]
Sequence
MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVEL
LSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTT
IHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTA
IDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTL
AGTRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGT
LPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQR
STGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFM
HKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFF
GIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTP
ADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTY
ELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPL
FKPSVSTSKAIGGGP
Download sequence
Identical sequences A0A2J8WJK3 H2QUZ0 Q9UJS0
ENSPTRP00000033227 ENSPTRP00000033227 9598.ENSPTRP00000033227 9606.ENSP00000265631 ENSP00000265631 NP_055066.1.87134 NP_055066.1.92137 XP_527824.3.37143 ENSP00000265631 GO.39295 HR6788 gi|7657581|ref|NP_055066.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]