SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7657649|ref|NP_055362.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7657649|ref|NP_055362.1|
Domain Number 1 Region: 184-347
Classification Level Classification E-value
Superfamily RNI-like 3.14e-45
Family 28-residue LRR 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|7657649|ref|NP_055362.1|
Sequence length 352
Comment tropomodulin-3 [Homo sapiens]
Sequence
MALPFRKDLEKYKDLDEDELLGNLSETELKQLETVLDDLDPENALLPAGFRQKNQTSKST
TGPFDREHLLSYLEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELE
EALTSASDTELCDLAAILGMHNLITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEP
PNPTNVEESLKRTKENDAHLVEVNLNNIKNIPIPTLKDFAKALETNTHVKCFSLAATRSN
DPVATAFAEMLKVNKTLKSLNVESNFITGVGILALIDALRDNETLAELKIDNQRQQLGTA
VELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGDHQ
Download sequence
Identical sequences Q9NYL9
NP_055362.1.87134 NP_055362.1.92137 XP_016877576.1.92137 XP_016877577.1.92137 ENSP00000308753 ENSP00000308753 ENSP00000438909 9606.ENSP00000308753 ENSP00000308753 ENSP00000438909 gi|7657649|ref|NP_055362.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]