SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7661860|ref|NP_055480.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7661860|ref|NP_055480.1|
Domain Number 1 Region: 193-415
Classification Level Classification E-value
Superfamily RNI-like 7.46e-23
Family 28-residue LRR 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7661860|ref|NP_055480.1|
Sequence length 493
Comment leucine-rich repeat-containing protein 14 [Homo sapiens]
Sequence
MHTLVFLSTRQVLQCQPAACQALPLLPRELFPLLFKVAFMDKKTVVLRELVHTWPFPLLS
FQQLLQECAHCSRALLQERPSTESMQAVILGLTARLHTSEPGASTQPLCRKHALRVLDMT
GLLDDGVEQDPGTMSMWDCTAAVARTCIAQQQGGAAEPGPAPIPVEVRVDLRVNRASYAF
LREALRSSVGSPLRLCCRDLRAEDLPMRNTVALLQLLDAGCLRRVDLRFNNLGLRGLSVI
IPHVARFQHLASLRLHYVHGDSRQPSVDGEDNFRYFLAQMGRFTCLRELSMGSSLLSGRL
DQLLSTLQSPLESLELAFCALLPEDLRFLARSPHAAHLKKLDLSGNDLSGSQLAPFQGLL
QASAATLLHLELTECQLADTQLLATLPILTQCASLRYLGLYGNPLSMAGLKELLRDSVAQ
AELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFARVEAELHQLLLASGRAHVLWTT
DIYGRLAADYFSL
Download sequence
Identical sequences G3REJ1 H2PRI1 K6ZV24 Q15048
ENSP00000292524 ENSPPYP00000021291 9600.ENSPPYP00000021291 9606.ENSP00000292524 ENSGGOP00000013979 ENSPPYP00000021291 NP_001258965.1.87134 NP_001258965.1.92137 NP_055480.1.87134 NP_055480.1.92137 XP_004047749.1.27298 XP_005272415.1.92137 XP_005272416.1.92137 XP_009242470.1.23681 XP_009242471.1.23681 XP_009454445.2.37143 XP_016815648.1.37143 XP_016815649.1.37143 XP_016815651.1.37143 XP_018887793.1.27298 XP_018887795.1.27298 XP_018887796.1.27298 HR6068 ENSP00000292524 ENSP00000434768 ENSGGOP00000013979 gi|7661860|ref|NP_055480.1| ENSP00000292524 ENSP00000434768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]