SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7661882|ref|NP_055697.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7661882|ref|NP_055697.1|
Domain Number 1 Region: 147-346
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00019
Further Details:      
 
Domain Number 2 Region: 30-143
Classification Level Classification E-value
Superfamily PH domain-like 1.36e-32
Family Pleckstrin-homology domain (PH domain) 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7661882|ref|NP_055697.1|
Sequence length 638
Comment rho GTPase-activating protein 25 isoform b [Homo sapiens]
Sequence
MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRY
FVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQD
SYVLMASSQAEMEEWVKFLRRVAGTPCGVFGQRLDETVAYEQKFGPHLVPILVEKCAEFI
LEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVV
PWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQLNCAVNKM
SVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDIPLSPPAQK
NDPKKAPVARSSVGWDATEDLRISRTDSFSSMTSDSDTTSPTGQQPSDAFPEDSSKVPRE
KPGDWKMQSRKRTQTLPNRKCFLTSAFQGANSSKMEIFKNEFWSPSSEAKAGEGHRRTMS
QDLRQLSDSQRTSTYDNVPSLPGSPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGE
EEIDSLQRMVQELRKEIETQKQMYEEQIKNLEKENYDVWAKVVRLNEELEKEKKKSAALE
ISLRNMERSREDVEKRNKALEEEVKEFVKSMKEPKTEA
Download sequence
Identical sequences V9HWC8
ENSP00000386863 NP_055697.1.87134 NP_055697.1.92137 ENSP00000386863 gi|7661882|ref|NP_055697.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]