SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7661962|ref|NP_055585.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7661962|ref|NP_055585.1|
Domain Number 1 Region: 578-689
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.49e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00032
Further Details:      
 
Domain Number 2 Region: 67-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-29
Family G proteins 0.0000000307
Further Details:      
 
Domain Number 3 Region: 701-793
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.57e-16
Family Ankyrin repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 338-403,518-561
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000276
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7661962|ref|NP_055585.1|
Sequence length 836
Comment arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 isoform PIKE-S [Homo sapiens]
Sequence
MHAQRQFVVAAVRAEVRRHEVAKQALNRLRKLAERVDDPELQDSIQASLDSIREAVINSQ
EWTLSRSIPELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVL
IREEAGAPDAKFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQ
DRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLL
AACKSLPSSPSHSAASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTP
GSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWK
KKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGL
VKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGD
LSPLSREPPPSPMVKKQRRKKLTTPSKTEGSAGQAEEENFEFLIVSSTGQTWHFEAASFE
ERDAWVQAIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTW
ASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGNDTANRVWESDTR
GRAKPSRDSSREERESWIRAKYEQLLFLAPLSTSEEPLGRQLWAAVQAQDVATVLLLLAH
ARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQGRTALFYARQAGS
QLCADILLQHGCPGEGGSAATTPSAATTPSITATPSPRRRSSAASVGRADAPVALV
Download sequence
Identical sequences A0A024RB55
ENSP00000257897 ENSP00000257897 NP_055585.1.87134 NP_055585.1.92137 gi|7661962|ref|NP_055585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]