SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7662070|ref|NP_055451.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7662070|ref|NP_055451.1|
Domain Number 1 Region: 14-304
Classification Level Classification E-value
Superfamily Ras GEF 8.63e-80
Family Ras GEF 0.0000357
Further Details:      
 
Domain Number 2 Region: 424-550
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-17
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|7662070|ref|NP_055451.1|
Sequence length 557
Comment ras-specific guanine nucleotide-releasing factor RalGPS1 isoform 1 [Homo sapiens]
Sequence
MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITL
MDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAE
ILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSK
EDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRII
ADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKE
DLAGPSAGSGSARFSRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSAT
FPSEKARHLLDDSVLESRSPRRGLALTSSSAVTNGLSLGSSESSEFSEEMSSGLESPTGP
CICSLGNSAAVPTMEGPLRRKTLLKEGRKPALSSWTRYWVILSGSTLLYYGAKSLRGTDR
KHYKSTPGKKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAILWHKHLDD
ACKSNRPQVPANLMSFE
Download sequence
Identical sequences A0A2I3S443 A0A2J8UKE1 A0A2K5WF82 A0A2K6SBL2 F6TUP7 G3RI41 Q5JS13
ENSMMUP00000038858 ENSMMUP00000015954 ENSP00000259351 gi|7662070|ref|NP_055451.1| ENSGGOP00000015329 ENSP00000259351 ENSP00000259351 ENSGGOP00000015329 NP_055451.1.87134 NP_055451.1.92137 XP_014972295.1.72884 XP_015292029.1.63531 XP_016817180.1.37143 XP_016817184.1.37143 XP_016870836.1.92137 XP_018889260.1.27298 9544.ENSMMUP00000038858 9606.ENSP00000259351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]