SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7662160|ref|NP_055589.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7662160|ref|NP_055589.1|
Domain Number 1 Region: 435-493
Classification Level Classification E-value
Superfamily EF-hand 0.00000587
Family Calmodulin-like 0.024
Further Details:      
 
Weak hits

Sequence:  gi|7662160|ref|NP_055589.1|
Domain Number - Region: 97-223
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00628
Family Hemolysin E (HlyE, ClyA, SheA) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|7662160|ref|NP_055589.1|
Sequence length 495
Comment hypothetical protein LOC9813 [Homo sapiens]
Sequence
MKKRKELNALIGLAGDSRRKKPKKGPSSHRLLRTEPPDSDSESSSEEEEEFGVVGNRSRF
AKGDYLRCCKICYPLCGFVILAACVVACVGLVWMQVALKEDLDALKEKFRTMESNQKSSF
QEIPKLNEELLSKQKQLEKIESGEMGLNKVWINITEMNKQISLLTSAVNHLKANVKSAAD
LISLPTTVEGLQKSVASIGNTLNSVHLAVEALQKTVDEHKKTMELLQSDMNQHFLKETPG
SNQIIPSPSATSELDNKTHSENLKQDILYLHNSLEEVNSALVGYQRQNDLKLEGMNETVS
NLTQRVNLIESDVVAMSKVEKKANLSFSMMGDRSATLKRQSLDQVTNRTDTVKIQSIKKE
DSSNSQVSKLREKLQLISALTNKPESNRPPETADEEQVESFTSKPSALPKFSQFLGDPVE
KAAQLRPISLPGVSSTEDLQDLFRKTGQDVDGKLTYQEIWTSLGSAMPEPESLRAFDSDG
DGRYSFLELRVALGI
Download sequence
Identical sequences O75071
ENSP00000361001 ENSP00000361001 NP_055589.1.87134 NP_055589.1.92137 ENSP00000361001 9606.ENSP00000361001 gi|7662160|ref|NP_055589.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]