SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7662234|ref|NP_055515.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7662234|ref|NP_055515.1|
Domain Number 1 Region: 705-756
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.00000000000000144
Family Eferin C-derminal domain-like 0.0000828
Further Details:      
 
Domain Number 2 Region: 199-272
Classification Level Classification E-value
Superfamily EF-hand 0.000000000228
Family Calmodulin-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|7662234|ref|NP_055515.1|
Sequence length 756
Comment rab11 family-interacting protein 3 isoform 1 [Homo sapiens]
Sequence
MASAPPASPPGSEPPGPDPEPGGPDGPGAAQLAPGPAELRLGAPVGGPDPQSPGLDEPAP
GAAADGGARWSAGPAPGLEGGPRDPGPSAPPPRSGPRGQLASPDAPGPGPRSEAPLPELD
PLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGS
PPQPSDLSQTHPLPSEPVGSQEDGPRLRAVFDALDGDGDGFVRIEDFIQFATVYGAEQVK
DLTKYLDPSGLGVISFEDFYQGITAIRNGDPDGQCYGGVASAQDEEPLACPDEFDDFVTY
EANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDADSAGGSAVPSECLDAMEE
PDHGALLLLPGRPHPHGQSVITVIGGEEHFEDYGEGSEAELSPETLCNGQLGCSDPAFLT
PSPTKRLSSKKVARYLHQSGALTMEALEDPSPELMEGPEEDIADKVVFLERRVLELEKDT
AATGEQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIE
IENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRM
GDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEYHSRARE
SELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDEL
MEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK
Download sequence
Identical sequences O75154
ENSP00000262305 ENSP00000482156 9606.ENSP00000262305 NP_055515.1.87134 NP_055515.1.92137 gi|7662234|ref|NP_055515.1| ENSP00000262305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]