SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7662284|ref|NP_055447.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7662284|ref|NP_055447.1|
Domain Number 1 Region: 388-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.48e-38
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 86-241,387-437
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.3e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.064
Further Details:      
 
Domain Number 3 Region: 994-1027
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000371
Family LIM domain 0.01
Further Details:      
 
Domain Number 4 Region: 1028-1057
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000627
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|7662284|ref|NP_055447.1|
Sequence length 1124
Comment protein MICAL-2 [Homo sapiens]
Sequence
MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTW
KAKALWYKLDKRGSHKEYKRGKSCTNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDS
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVN
VEFVKVLEPPEDQENQKIGWRAEFLPTDHSLSEFEFDVIIGADGRRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV
MTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQLPSLDFAMNH
YGQPDVAMFDFTCMYASENAALVRERQAHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKSWNQGTPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSHCVR
PHQVKHLYITKELEHYPLERLGSVRRSVNLSRKESDIRPSKLLTWCQQQTEGYQHVNVTD
LTTSWRSGLALCAIIHRFRPELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMA
SAQEPDKLSMVMYLSKFYELFRGTPLRPVDSWRKNYGENADLSLAKSSISNNYLNLTFPR
KRTPRVDGQTGENDMNKRRRKGFTNLDEPSNFSSRSLGSNQECGSSKEGGNQNKVKSMAN
QLLAKFEESTRNPSLMKQERRVSGIGKPVLCSSSGPPVHSCCPKPEEATPSPSPPLKRQF
PSVVVTGHVLRELKQVSAGSECLSRPWRARAKSDLQLGGTENFATLPSTRPRAQALSGVL
WRLQQVEEKILQKRAQNLANREFHTKNIKEKAAHLASMFGHGDFPQNKLLSKGLSHTHPP
SPPSRLPSPDPAASSSPSTVDSASPARKEKKSPSGFHFHPSHLRTVHPQLTVGKVSSGIG
AAAEVLVNLYMNDHRPKAQATSPDLESMRKSFPLNLGGSDTCYFCKKRVYVMERLSAEGH
FFHRECFRCSICATTLRLAAYTFDCDEGKFYCKPHFIHCKTNSKQRKRRAELKQQREEEA
TWQEQEAPRRDTPTESSCAVAAIGTLEGSPPVHFSLPVLHPLLG
Download sequence
Identical sequences O94851
9606.ENSP00000256194 NP_001269592.1.87134 NP_001269592.1.92137 NP_055447.1.87134 NP_055447.1.92137 XP_016874078.1.92137 XP_016874079.1.92137 gi|7662284|ref|NP_055447.1| ENSP00000256194 ENSP00000256194 ENSP00000256194 ENSP00000441689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]