SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7662310|ref|NP_055623.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7662310|ref|NP_055623.1|
Domain Number 1 Region: 536-747
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-52
Family DBL homology domain (DH-domain) 0.00039
Further Details:      
 
Domain Number 2 Region: 227-372
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-42
Family Third domain of FERM 0.00047
Further Details:      
 
Domain Number 3 Region: 870-1024
Classification Level Classification E-value
Superfamily PH domain-like 8.04e-33
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 4 Region: 731-856
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-30
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 5 Region: 126-226
Classification Level Classification E-value
Superfamily Second domain of FERM 4.58e-28
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 6 Region: 46-126
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.16e-20
Family First domain of FERM 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|7662310|ref|NP_055623.1|
Sequence length 1054
Comment FERM, RhoGEF and pleckstrin domain-containing protein 2 [Homo sapiens]
Sequence
MGEIEGTYRVLQTAGMRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDI
EPKCDGQVLLTQVWKRLNLVECDYFGMEFQNTQSYWIWLEPMKPIIRQIRRPKNVVLRLA
VKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYDETLD
REHLKVNEYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDRE
GTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYFKDSGM
KRIPYERRHSKTHTSVRALTADLPKQSISFPEGLRTPASPSSANAFYSLSPSTLVPSGLP
EFKDSSSSLTDPQVSYVKSPAAERRSGAVAGGPDTPSAQPLGPPALQPGPGLSTKSPQPS
PSSRKSPLSLSPAFQVPLGPAEQGSSPLLSPVLSDAGGAGMDCEEPRHKRVPADEAYFIV
KEILATERTYLKDLEVITVWFRSAVVKEDAMPATLMTLLFSNIDPIYEFHRGFLREVEQR
LALWEGPSKAHTKGSHQRIGDILLRNMRQLKEFTSYFQRHDEVLTELEKATKRCKKLEAV
YKEFELQKVCYLPLNTFLLKPIQRLLHYRLLLRRLCGHYSPGHHDYADCHDALKAITEVT
TTLQHILIRLENLQKLTELQRDLVGIENLIAPGREFIREGCLHKLTKKGLQQRMFFLFSD
MLLYTSKGVAGTSHFRIRGLLPLQGMLVEESDNEWSVPHCFTIYAAQKTIVVAASTRLEK
EKWMLDLNSAIQAAKSGGDTAPALPGRTVCTRPPRSPNEVSLEQESEDDARGVRSSLEGH
GQHRANTTMHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSHGWQKLWVVFTNFCLFF
YKTHQDDYPLASLPLLGYSVSIPREADGIHKDYVFKLQFKSHVYFFRAESKYTFERWMEV
IQGASSSAGRAPSIVQDGPQPSSGLEGMVRGKEE
Download sequence
Identical sequences O94887
NP_055623.1.87134 NP_055623.1.92137 ENSP00000264042 ENSP00000264042 gi|7662310|ref|NP_055623.1| 9606.ENSP00000264042 ENSP00000264042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]