SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7662320|ref|NP_055628.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7662320|ref|NP_055628.1|
Domain Number 1 Region: 96-483
Classification Level Classification E-value
Superfamily L domain-like 1.14e-62
Family Internalin LRR domain 0.075
Further Details:      
 
Domain Number 2 Region: 689-784
Classification Level Classification E-value
Superfamily Immunoglobulin 2.99e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 604-700
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-20
Family I set domains 0.0093
Further Details:      
 
Domain Number 4 Region: 497-606
Classification Level Classification E-value
Superfamily Immunoglobulin 2.67e-18
Family I set domains 0.019
Further Details:      
 
Weak hits

Sequence:  gi|7662320|ref|NP_055628.1|
Domain Number - Region: 46-114
Classification Level Classification E-value
Superfamily L domain-like 0.0748
Family Ngr ectodomain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7662320|ref|NP_055628.1|
Sequence length 1065
Comment leucine-rich repeats and immunoglobulin-like domains protein 2 precursor [Homo sapiens]
Sequence
MAPAPLGVPEEQLLGCRSRVLSRLLFIAQTALLLLPAAGAGLCPAPCSCRIPLLDCSRRK
LPAPSWRALSGLLPPDTAILDFSHNRLSNWNISLESQTLQEVKMNYNELTEIPYFGEPTS
NITLLSLVHNIIPEINAQALQFYPALESLDLSSNIISEIKTSSFPRMQLKYLNLSNNRIT
TLEAGCFDNLSSSLLVVKLNRNRMSMIPPKIFKLPHLQFLELKRNRIKIVEGLTFQGLDS
LRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTRVNKGWLYGLRMLQQLYVSQNAIE
RISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSN
LQTLDLRNNEISWAIEDASEAFAGLTSLTKLILQGNQIKSITKKAFIGLESLEHLDLNNN
AIMSIQENAFSQTHLKELILNTSSLLCDCHLKWLLQWLVDNNFQHSVNVSCAHPEWLAGQ
SILNVDLKDFVCDDFLKPQIRTHPETIIALRGMNVTLTCTAVSSSDSPMSTVWRKDSEIL
YDVDTENFVRYWQQAGEALEYTSILHLFNVNFTDEGKYQCIVTNHFGSNYSQKAKLTVNE
MPSFLKTPMDLTIRTGAMARLECAAEGHPAPQISWQKDGGTDFPAARERRMHVMPEDDVF
FIANVKIEDMGIYSCMAQNTAGGLSANASLTVLETPSFIRPLEDKTVTRGETAVLQCIAG
GSPAPRLNWTKDDGPLLVTERHFFAAANQLLIIVDAGLEDAGKYTCIMSNTLGTERGHIY
LNVISSPNCDSSQSSIGHEDDGWTTVGIVIIVVVCCVVGTSLIWVIVIYHMRRKNEDYSI
TNTEELNLPADIPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYIHKGTDGGTGTRV
ICSDCYDNANIYSRTREYCPYTYIAEEDVLDQTLSSLMVQMPKETYLVHPPQDTTALESL
IPSANREPSAFPTNHERISEKKLPSTQMSGETLQRPVWNINRELGLPHPPFSQQPVHESP
QLHQNEGLAGREPDCSASSMSCHRLQDHAFDFSRTRNIQDGSEGT
Download sequence
Identical sequences O94898
NYSGRC-IgSF-LRIG2_HUMAN NP_055628.1.87134 NP_055628.1.92137 ENSP00000355396 ENSP00000355396 ENSP00000355396 gi|7662320|ref|NP_055628.1| 9606.ENSP00000355396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]