SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7662334|ref|NP_056191.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7662334|ref|NP_056191.1|
Domain Number 1 Region: 6-411
Classification Level Classification E-value
Superfamily Ras GEF 1.83e-102
Family Ras GEF 0.00026
Further Details:      
 
Domain Number 2 Region: 483-543
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.83e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00099
Further Details:      
 
Domain Number 3 Region: 417-480
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000165
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7662334|ref|NP_056191.1|
Sequence length 689
Comment ras guanyl-releasing protein 3 isoform 2 [Homo sapiens]
Sequence
MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYR
NATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDI
SSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSPTSPTTPNKPVVPLEWALGVMPKPDPTVINKHI
RKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRA
KSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLV
LACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKI
SVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVH
AGVDVVDRGTEFELDQDEGEETRQDGEDG
Download sequence
Identical sequences ENSP00000383917 gi|7662334|ref|NP_056191.1| ENSP00000383917 NP_056191.1.87134 NP_056191.1.92137 XP_005264303.1.92137 XP_016859251.1.92137 XP_016859252.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]